Pfam domain
Pfam family: HGTP_anticodon (PF03129.19)
Uniprot AC: P41250
RecName: Glycine--tRNA ligase
Begin-End: 615-709
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDF
DTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDL
Structures of the domain P41250 615-709
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kr2 X-ray 3.29 A 561-654 None
4kr3 X-ray 3.23 A 561-654 None
5e6m X-ray 2.93 B 561-654 None
5e6m X-ray 2.93 A 561-654 None


© NPIDB team 2003 - 2019

text