Pfam domain
Pfam family: SUI1 (PF01253.21)
Uniprot AC: P41567
RecName: Eukaryotic translation initiation factor 1
Begin-End: 29-103
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGD
QRKNICQFLVEIGLA
Structures of the domain P41567 29-103
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kzx X-ray 7.81 l 30-101 None
4kzy X-ray 7.01 l 2-73 None


© NPIDB team 2003 - 2019

text