Pfam domain
Pfam family: tRNA-synt_1 (PF00133.21)
Uniprot AC: P41972
RecName: Isoleucine--tRNA ligase
Begin-End: 26-634
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
QIQEKWDAEDQYHKALEKNKGNETFILHDGPPYANGNLHMGHALNKILKDFIVRYKTMQG
FYAPYVPGWDTHGLPIEQALTKKGVDRKKMSTAEFREKCKEFALEQIELQKKDFRRLGVR
GDFNDPYITLKPEYEAAQIRIFGEMADKGLIYKGKKPVYWSPSSESSLAEAEIEYHDKRS
ASIYVAFNVKDDKGVVDADAKFIIWTTTPWTIPSNVAITVHPELKYGQYNVNGEKYIIAE
ALSDAVAEALDWDKASIKLEKEYTGKELEYVVAQHPFLDRESLVINGDHVTTDAGTGCVH
TAPGHGEDDYIVGQKYELPVISPIDDKGVFTEEGGQFEGMFYDKANKAVTDLLTEKGALL
KLDFITHSYPHDWRTKKPVIFRATPQWFASISKVRQDILDAIENTNFKVNWGKTRIYNMV
RDRGEWVISRQRVWGVPLPVFYAENGEIIMTKETVNHVADLFAEHGSNIWFEREAKDLLP
EGFTHPGSPNGTFTKETDIMDVWFDSGSSHRGVLETRPELSFPADMYLEGSDQYRGWFNS
SITTSVATRGVSPYKFLLSHGFVMDGEGKKMSKSLGNVIVPDQVVKQKGADIARLWVSST
DYLADVRIS
Structures of the domain P41972 26-634
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ffy X-ray 2.2 A 26-634 None
1qu2 X-ray 2.2 A 26-634 None
1qu3 X-ray 2.9 A 26-634 None


© NPIDB team 2003 - 2019

text