Pfam domain
Pfam family: Anticodon_1 (PF08264.12)
Uniprot AC: P41972
RecName: Isoleucine--tRNA ligase
Begin-End: 678-831
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
DRYLLNRLREFTASTINNYENFDYLNIYQEVQNFINVELSNFYLDYGKDILYIEQRDSHI
RRSMQTVLYQILVDMTKLLAPILVHTAEEVWSHTPHVKEESVHLADMPKVVEVDQALLDK
WRTFMNLRDDVNRALETARNEKVIGKSLEAKVTI
Structures of the domain P41972 678-831
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ffy X-ray 2.2 A 678-831 None
1qu2 X-ray 2.2 A 678-831 None
1qu3 X-ray 2.9 A 678-831 None


© NPIDB team 2003 - 2019

text