Pfam domain
Pfam family: zf-FPG_IleRS (PF06827.13)
Uniprot AC: P41972
RecName: Isoleucine--tRNA ligase
Begin-End: 883-912
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
GEKCERCWNYSEDLGAVDELTHLCPRCQQV
Structures of the domain P41972 883-912
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ffy X-ray 2.2 A 883-912 None
1qu2 X-ray 2.2 A 883-912 None


© NPIDB team 2003 - 2019

text