Pfam domain
Pfam family: Ribosomal_L22 (PF00237.18)
Uniprot AC: P42060
RecName: 50S ribosomal protein L22
Begin-End: 5-108
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
AVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEHNYEM
DANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHITIVVS
Structures of the domain P42060 5-108
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j3v X-ray 13.3 S 5-107 None
3j3w X-ray 10.7 S 5-107 None


© NPIDB team 2003 - 2019

text