Pfam domain
Pfam family: SH2 (PF00017.26)
Uniprot AC: P42226
RecName: Signal transducer and activator of transcription 6
Begin-End: 537-616
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LIIGFISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKD
LSIRSLGDRIRDLAQLKNLY
Structures of the domain P42226 537-616
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4y5w X-ray 3.1 C 537-616 None
4y5w X-ray 3.1 A 537-616 None
4y5w X-ray 3.1 B 537-616 None
4y5w X-ray 3.1 D 537-616 None
5d39 X-ray 3.2 C 537-616 None
5d39 X-ray 3.2 A 537-616 None
5d39 X-ray 3.2 D 537-616 None
5d39 X-ray 3.2 C 537-616 None
5d39 X-ray 3.2 A 537-616 None
5d39 X-ray 3.2 B 537-616 None
5d39 X-ray 3.2 B 537-616 None
5d39 X-ray 3.2 D 537-616 None


© NPIDB team 2003 - 2021

text