Pfam domain
Pfam family: STAT_alpha (PF01017.19)
Uniprot AC: P42227
RecName: Signal transducer and activator of transcription 3
Begin-End: 141-313
Organism: Mus musculus
Interaction Mode:   

Sequence:
QQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKM
QQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICL
DRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELF
Structures of the domain P42227 141-313
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1bg1 X-ray 2.25 A 141-319 None
4e68 X-ray 2.58 A 141-319 None


© NPIDB team 2003 - 2019

text