Pfam domain
Pfam family: STAT_bind (PF02864.14)
Uniprot AC: P42227
RecName: Signal transducer and activator of transcription 3
Begin-End: 325-464
Organism: Mus musculus
Interaction Mode:   

Sequence:
RQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKF
NILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETE
VYHQGLKIDLETHSLPVVVI
Structures of the domain P42227 325-464
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1bg1 X-ray 2.25 A 321-573 None
4e68 X-ray 2.58 A 321-573 None


© NPIDB team 2003 - 2019

text