Pfam domain
Pfam family: SH2 (PF00017.23)
Uniprot AC: P42227
RecName: Signal transducer and activator of transcription 3
Begin-End: 584-674
Organism: Mus musculus
Interaction Mode:   

Sequence:
YIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQ
QLNNMSFAEIIMGYKIMDATNILVSPLVYLY
Structures of the domain P42227 584-674
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1bg1 X-ray 2.25 A 584-674 None
4e68 X-ray 2.58 A 584-674 None


© NPIDB team 2003 - 2019

text