Pfam domain
Pfam family: H2TH (PF06831.16)
Uniprot AC: P42371
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 132-219
Organism: Lactococcus lactis subsp. cremoris
Interaction Mode:  H-Bb L-Bb 

Sequence:
IGPEPTYDEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKET
NQLIESSIHLLHDSIIEILQKAIKLGGS
Structures of the domain P42371 132-219
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rnr X-ray 2 A 131-227  H-Bb 
6rp0 X-ray 2.25 A 131-227  H-Bb L-Bb 
1nnj X-ray 1.9 A 131-227  H-Bb 
1kfv X-ray 2.55 B 131-234  H-Bb 
1kfv X-ray 2.55 A 131-230  H-Bb 
2xzu X-ray 1.82 A 131-227  H-Bb 
2xzf X-ray 1.8 A 131-227  H-Bb 
4pdg X-ray 2.4 A 131-227  H-Bb L-Bb 
6ro2 X-ray 1.82 A 131-227  H-Bb 


© NPIDB team 2003 - 2021

text