Pfam domain
Pfam family: H2TH (PF06831.13)
Uniprot AC: P42371
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 132-219
Organism: Lactococcus lactis subsp. cremoris
Interaction Mode:   

Sequence:
IGPEPTYDEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKET
NQLIESSIHLLHDSIIEILQKAIKLGGS
Structures of the domain P42371 132-219
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xzu X-ray 1.82 A 131-218 None
1nnj X-ray 1.9 A 131-219 None
1kfv X-ray 2.55 B 131-230 None
1kfv X-ray 2.55 A 131-228 None
2xzf X-ray 1.8 A 131-218 None
4pdg X-ray 2.4 A 131-218 None


© NPIDB team 2003 - 2019

text