Pfam domain
Pfam family: H2TH (PF06831.13)
Uniprot AC: P42371
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 132-225
Organism: Lactococcus lactis subsp. cremoris
Interaction Mode:   

Sequence:
IGPEPTYDEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKET
NQLIESSIHLLHDSIIEILQKAIKLGGSSIRTYS
Structures of the domain P42371 132-225
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1pji X-ray 1.9 A 131-223 None
3c58 X-ray 1.9 A 131-220 None
1pjj X-ray 1.9 A 131-221 None
1pm5 X-ray 1.95 A 131-221 None
1xc8 X-ray 1.95 A 131-221 None
1tdz X-ray 1.8 A 131-219 None
4pd2 X-ray 1.65 A 131-221 None
4pdi X-ray 2.1 A 131-220 None
4pcz X-ray 1.7 A 131-221 None


© NPIDB team 2003 - 2019

text