Pfam domain
Pfam family: Fapy_DNA_glyco (PF01149.23)
Uniprot AC: P42371
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 2-115
Organism: Lactococcus lactis subsp. cremoris
Interaction Mode:   

Sequence:
PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKELTGKTIQGISRRGKYLI
FEIGDDFRLISHLRMEGKYRLATLDAPREKHDHLTMKFADGQLIYADVRKFGTW
Structures of the domain P42371 2-115
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xzu X-ray 1.82 A 1-114 None
1pji X-ray 1.9 A 1-114 None
1nnj X-ray 1.9 A 2-114 None
3c58 X-ray 1.9 A 1-114 None
1pjj X-ray 1.9 A 2-114 None
1pm5 X-ray 1.95 A 1-114 None
1kfv X-ray 2.55 B 2-114 None
1kfv X-ray 2.55 A 2-114 None
1xc8 X-ray 1.95 A 1-114 None
1tdz X-ray 1.8 A 2-114 None
2xzf X-ray 1.8 A 1-114 None
4pd2 X-ray 1.65 A 1-114 None
4pdg X-ray 2.4 A 1-114 None
4pdi X-ray 2.1 A 1-114 None
4pcz X-ray 1.7 A 1-114 None


© NPIDB team 2003 - 2019

text