Pfam domain
Pfam family: zf-FPG_IleRS (PF06827.13)
Uniprot AC: P42371
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 244-273
Organism: Lactococcus lactis subsp. cremoris
Interaction Mode:   

Sequence:
GEKCSRCGAEIQKIKVAGRGTHFCPVCQQK
Structures of the domain P42371 244-273
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xzu X-ray 1.82 A 242-270 None
1pji X-ray 1.9 A 242-270 None
1nnj X-ray 1.9 A 242-270 None
3c58 X-ray 1.9 A 242-270 None
1pjj X-ray 1.9 A 242-270 None
1pm5 X-ray 1.95 A 242-270 None
1kfv X-ray 2.55 B 242-270 None
1kfv X-ray 2.55 A 242-270 None
1xc8 X-ray 1.95 A 242-270 None
1tdz X-ray 1.8 A 242-270 None
2xzf X-ray 1.8 A 242-270 None
4pd2 X-ray 1.65 A 242-271 None
4pdg X-ray 2.4 A 242-270 None
4pdi X-ray 2.1 A 242-270 None
4pcz X-ray 1.7 A 242-270 None


© NPIDB team 2003 - 2019

text