Pfam domain
Pfam family: DNA_pol_B_thumb (PF14791.5)
Uniprot AC: P42494
RecName: Repair DNA polymerase X
Begin-End: 112-174
Organism: African swine fever virus
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb 

Sequence:
AIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPK
KRL
Structures of the domain P42494 112-174
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xm8 X-ray 2.55 A 112-173  H-Bb H-Mj H-Mn S-Bb L-Bb 
5xm8 X-ray 2.55 B 112-173  H-Bb H-Mj H-Mn S-Bb L-Bb 
5xm8 X-ray 2.55 C 112-173  H-Bb H-Mj H-Mn S-Bb L-Bb 
5xm8 X-ray 2.55 D 112-173  H-Bb H-Mj H-Mn S-Bb L-Bb 
2m2w NMR A 112-173 None
5xma X-ray 3.8 B 112-173  H-Bb H-Mj H-Mn 
5xma X-ray 3.8 A 112-173  H-Bb H-Mj H-Mn 
5xm9 X-ray 3.05 B 112-173  H-Bb H-Mj H-Mn 
5xm9 X-ray 3.05 A 112-173  H-Bb H-Mj H-Mn 
5xm9 X-ray 3.05 D 112-173  H-Bb H-Mj H-Mn 
5xm9 X-ray 3.05 C 112-173  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2020

text