Pfam domain
Pfam family: DNA_pol_B_thumb (PF14791.8)
Uniprot AC: P42494
RecName: Repair DNA polymerase X
Begin-End: 112-174
Organism: African swine fever virus
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
AIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPK
KRL
Structures of the domain P42494 112-174
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xm8 X-ray 2.55 C 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb 
5xm8 X-ray 2.55 D 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb 
5xm8 X-ray 2.55 B 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb 
5xm8 X-ray 2.55 A 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb 
5hr9 X-ray 2.2 B 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5hr9 X-ray 2.2 A 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5hrb X-ray 1.7 A 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5hrd X-ray 1.8 D 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5hrd X-ray 1.8 C 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5hrd X-ray 1.8 B 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5hrd X-ray 1.8 A 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5hrl X-ray 2.4 B 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5hrl X-ray 2.4 A 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5hre X-ray 1.75 A 112-174 None
5hrf X-ray 2.25 B 112-174  H-Bb H-Mn S-Bb L-Bb L-Mn 
5hrf X-ray 2.25 A 112-174  H-Bb H-Mn S-Bb L-Bb L-Mn 
5hrg X-ray 2 A 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5hrg X-ray 2 B 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5hrh X-ray 3 B 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb 
5hrh X-ray 3 A 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb 
5hri X-ray 2.2 B 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5hri X-ray 2.2 A 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5hrk X-ray 2.9 B 112-174  H-Bb H-Mj H-Mn S-Bb L-Bb 
5hrk X-ray 2.9 A 112-174  H-Bb H-Mn L-Bb L-Mj L-Mn 
2m2w NMR A 112-174 None
5xma X-ray 3.8 B 112-174  H-Bb H-Mj H-Mn 
5xma X-ray 3.8 A 112-174  H-Bb H-Mj H-Mn 
5xm9 X-ray 3.05 D 112-174  H-Bb H-Mj H-Mn 
5xm9 X-ray 3.05 C 112-174  H-Bb H-Mj H-Mn 
5xm9 X-ray 3.05 B 112-174  H-Bb H-Mj H-Mn 
5xm9 X-ray 3.05 A 112-174  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2021

text