Pfam domain
Pfam family: Ribosomal_S27e (PF01667.16)
Uniprot AC: P42677
RecName: 40S ribosomal protein S27
Begin-End: 28-82
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRK
Structures of the domain P42677 28-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 b 47-101 None
5flx X-ray 3.9 b 28-82 None
5oa3 X-ray 4.3 b 28-82 None


© NPIDB team 2003 - 2020

text