Pfam domain
Pfam family: Ribosomal_L2 (PF00181.22)
Uniprot AC: P42919
RecName: 50S ribosomal protein L2
Begin-End: 42-118
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
GRNNQGKLTVRHQGGGHKRQYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEK
RYILAPKGIQVGTEIMS
Structures of the domain P42919 42-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j3v X-ray 13.3 C 42-117 None
3j3w X-ray 10.7 C 42-117 None


© NPIDB team 2003 - 2019

text