Pfam domain
Pfam family: Ribosomal_L3 (PF00297.21)
Uniprot AC: P42920
RecName: 50S ribosomal protein L3
Begin-End: 85-184
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
GVEMDAYEVGQEVKVEIFSAGEIVDVTGVSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPG
SMGPVDPNRVFKGKLLPGRMGGEQITVQNLEIVKVDAERN
Structures of the domain P42920 85-184
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j3v X-ray 13.3 D 99-181 None
3j3w X-ray 10.7 D 99-181 None


© NPIDB team 2003 - 2019

text