Pfam domain
Pfam family: MutS_V (PF00488.23)
Uniprot AC: P43246
RecName: DNA mismatch repair protein Msh2
Begin-End: 665-852
Organism: Homo sapiens
Interaction Mode:   

Sequence:
HIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVST
FMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHF
HELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECA
KQKALELE
Structures of the domain P43246 665-852
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3thz X-ray 4.3 A 665-852 None
2o8f X-ray 3.25 A 665-852 None
2o8b X-ray 2.75 A 665-852 None
2o8c X-ray 3.37 A 665-852 None
2o8d X-ray 3 A 665-852 None
2o8e X-ray 3.3 A 665-852 None
3thw X-ray 3.09 A 665-852 None
3thx X-ray 2.7 A 665-852 None
3thy X-ray 2.89 A 665-852 None


© NPIDB team 2003 - 2021

text