Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: P43268
RecName: ETS translocation variant 4
Begin-End: 342-421
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRY
YYEKGIMQKVAGERYVYKFV
Structures of the domain P43268 342-421
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4uuv X-ray 2.8 A 342-421 None
4uuv X-ray 2.8 P 342-421 None
4uuv X-ray 2.8 V 342-421 None
4uuv X-ray 2.8 J 342-421 None
4uuv X-ray 2.8 S 342-421 None
4uuv X-ray 2.8 M 342-421 None
4uuv X-ray 2.8 D 342-421 None
4uuv X-ray 2.8 G 342-421 None


© NPIDB team 2003 - 2019

text