Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P43321
RecName: Small nuclear ribonucleoprotein Sm D3
Begin-End: 9-74
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQ
IKFIVV
Structures of the domain P43321 9-74
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 U 10-73 None
5wsg X-ray 4 l 10-73 None
5gmk X-ray 3.4 y 10-73 None
5gmk X-ray 3.4 l 10-73 None
6bk8 X-ray 3.3 g 9-72 None
6bk8 X-ray 3.3 o 36-141 None
5lj3 X-ray 3.8 n 12-75 None
5lj3 X-ray 3.8 d 8-71 None
5mps X-ray 3.85 d 10-73 None
5lj5 X-ray 3.8 n 10-73 None
5lj5 X-ray 3.8 d 10-73 None
3jcm X-ray 3.8 J 10-73 None
3jcm X-ray 3.8 R 10-73 None
5gam X-ray 3.7 d 10-73 None
5uz5 X-ray 3.56 N 10-73 None
5gao X-ray 3.6 n 10-73 None


© NPIDB team 2003 - 2019

text