Pfam domain
Pfam family: HMG_box (PF00505.18)
Uniprot AC: P43680
RecName: Transcription factor SOX-18
Begin-End: 79-147
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mn 

Sequence:
IRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERLRVQ
HLRDHPNYK
Structures of the domain P43680 79-147
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4y60 X-ray 1.75 C 4-71  H-Bb H-Mj H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2019

text