Pfam domain
Pfam family: Cas_Cas2CT1978 (PF09707.9)
Uniprot AC: P45956
RecName: CRISPR-associated endoribonuclease Cas2
Begin-End: 3-88
Organism: Escherichia coli
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
MLVVVTENVPPRLRGRLAIWLLEVRAGVYVGDVSAKIREMIWEQIAGLAEEGNVVMAWAT
NTETGFEFQTFGLNRRTPVDLDGLRL
Structures of the domain P45956 3-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ds5 X-ray 2.95 E 3-88 None
5ds5 X-ray 2.95 F 3-88 None
5vvk X-ray 2.9 F 3-88 None
5vvk X-ray 2.9 E 3-88 None
5dqu X-ray 4.5 F 3-88 None
5dqu X-ray 4.5 E 3-88 None
5dqz X-ray 2.7 E 3-88  H-Bb S-Bb L-Bb 
5dqz X-ray 2.7 F 3-88  H-Bb S-Bb L-Bb 
5ds6 X-ray 3.35 F 3-88  H-Bb L-Bb 
5ds6 X-ray 3.35 E 3-88  H-Bb S-Bb L-Bb 
5vvl X-ray 3.31 F 3-88 None
5vvl X-ray 3.31 E 3-88 None
5ds4 X-ray 3.2 F 3-88 None
5ds4 X-ray 3.2 E 3-88 None
5dqt X-ray 3.1 E 3-88 None
5dqt X-ray 3.1 F 3-88 None
5dqt X-ray 3.1 N 3-88 None
5dqt X-ray 3.1 M 3-88 None
5vvj X-ray 3.89 F 3-88 None
5vvj X-ray 3.89 E 3-88 None
5wfe X-ray 3.64 F 3-88  H-Bb S-Bb L-Bb 
5wfe X-ray 3.64 E 3-88  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text