Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: P46063
RecName: ATP-dependent DNA helicase Q1
Begin-End: 299-409
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DFIEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKTTVHR
KWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDD
Structures of the domain P46063 299-409
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2wwy X-ray 2.9 B 301-407 None
2wwy X-ray 2.9 A 301-407 None
4u7d X-ray 3.4 C 301-407 None
4u7d X-ray 3.4 A 301-407 None
4u7d X-ray 3.4 B 301-407 None
4u7d X-ray 3.4 A 301-407 None
4u7d X-ray 3.4 A 301-407 None
4u7d X-ray 3.4 D 301-407 None


© NPIDB team 2003 - 2019

text