Pfam domain
Pfam family: Ank_2 (PF12796.9)
Uniprot AC: P46531
RecName: Neurogenic locus notch homolog protein 1
Begin-End: 1971-2058
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKS
ALHWAAAVNNVDAAVVLLKNGANKDMQN
Structures of the domain P46531 1971-2058
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2f8x X-ray 3.25 K 2006-2093 None
3nbn X-ray 3.45 E 1924-1993 None
3nbn X-ray 3.45 B 1924-1993 None
3v79 X-ray 3.85 K 2006-2093 None
6py8 X-ray 3.75 F 1904-1993 None
6py8 X-ray 3.75 K 1905-1993 None


© NPIDB team 2003 - 2021

text