Pfam domain
Pfam family: Ank_2 (PF12796.9)
Uniprot AC: P46531
RecName: Neurogenic locus notch homolog protein 1
Begin-End: 1999-2092
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQN
NREETPLFLAAREGSYETAKVLLDHFANRDITDH
Structures of the domain P46531 1999-2092
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3nbn X-ray 3.45 E 2005-2094 None
3nbn X-ray 3.45 B 2005-2094 None
6py8 X-ray 3.75 F 2000-2093 None
6py8 X-ray 3.75 K 2007-2093 None


© NPIDB team 2003 - 2021

text