Pfam domain
Pfam family: RPA43_OB (PF17875.3)
Uniprot AC: P46669
RecName: DNA-directed RNA polymerase I subunit RPA43
Begin-End: 127-250
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDVEEDADVINTDENN
GNNNNEDNKDSNGGSNSLGKFSFGNRSLGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVD
GTLI
Structures of the domain P46669 127-250
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tps X-ray 3.54 G 127-216 None
6ruo X-ray 3.5 G 127-214 None
6rql X-ray 2.9 G 127-214 None
5n61 X-ray 3.4 G 127-216 None
5m3f X-ray 3.8 G 127-216 None
6h67 X-ray 3.6 G 127-216 None
6rqh X-ray 3.7 G 127-214 None
6rwe X-ray 3 G 127-214 None


© NPIDB team 2003 - 2021

text