Pfam domain
Pfam family: SHS2_Rpb7-N (PF03876.16)
Uniprot AC: P46669
RecName: DNA-directed RNA polymerase I subunit RPA43
Begin-End: 44-125
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLSKEDTSEK
LIKITPDTPFGFTWCHVNLYVW
Structures of the domain P46669 44-125
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5w65 X-ray 4.3 G 45-125 None
5w5y X-ray 3.8 G 45-125 None
5w66 X-ray 3.9 G 45-125 None
5m5x X-ray 4 G 45-125 None
5m5y X-ray 4 G 45-125 None
5w64 X-ray 4.2 G 45-125 None
5oa1 X-ray 4.4 G 45-125 None
5m3f X-ray 3.8 G 45-125 None


© NPIDB team 2003 - 2019

text