Pfam domain
Pfam family: Myb_DNA-bind_7 (PF15963.7)
Uniprot AC: P46678
RecName: Transcription factor TFIIIB component B''
Begin-End: 95-182
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IDASTQNPKADVIEDNVTLKPAPLQTHRDQKVPRSSRLASLSKDNESRPSFKPSFLDSSS
NSNGTARRLSTISNKLPKKIRLGSITEN
Structures of the domain P46678 95-182
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cnc X-ray 4.1 S 410-497  H-Bb L-Bb 
6f41 X-ray 4.3 W 410-497  H-Bb L-Bb 
6cnf X-ray 4.5 S 410-497  H-Bb L-Bb 
6f40 X-ray 3.7 W 410-497  H-Bb L-Bb L-Mn 
6cnb X-ray 4.1 S 410-497  H-Bb L-Bb 
6cnd X-ray 4.8 S 410-497  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text