Pfam domain
Pfam family: S4 (PF01479.24)
Uniprot AC: P46781
RecName: 40S ribosomal protein S9
Begin-End: 108-154
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQ
Structures of the domain P46781 108-154
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 J 108-151 None
5flx X-ray 3.9 J 108-151 None
5oa3 X-ray 4.3 J 108-151 None


© NPIDB team 2003 - 2020

text