Pfam domain
Pfam family: Ribosomal_S4 (PF00163.18)
Uniprot AC: P46781
RecName: 40S ribosomal protein S9
Begin-End: 9-140
Organism: Homo sapiens
Interaction Mode:   

Sequence:
CRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDP
RRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARV
LIRQRHIRVRKQ
Structures of the domain P46781 9-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 J 19-63 None
5flx X-ray 3.9 J 19-63 None
5oa3 X-ray 4.3 J 19-63 None


© NPIDB team 2003 - 2019

text