Pfam domain
Pfam family: Ribosomal_S7 (PF00177.20)
Uniprot AC: P46782
RecName: 40S ribosomal protein S5
Begin-End: 51-204
Organism: Homo sapiens
Interaction Mode:   

Sequence:
HSAGRYAAKRFRKAQCPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQ
VLVNAIINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIA
ECLADELINAAKGSSNSYAIKKKDELERVAKSNR
Structures of the domain P46782 51-204
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 F 124-204 None
5flx X-ray 3.9 F 126-204 None
5oa3 X-ray 4.3 F 124-204 None


© NPIDB team 2003 - 2020

text