Pfam domain
Pfam family: Ribosomal_L6 (PF00347.22)
Uniprot AC: P46898
RecName: 50S ribosomal protein L6
Begin-End: 11-83
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
IPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEIKVEDNVLTVARPSDQKEHRALHGTTR
SLLGNMVEGVSKG
Structures of the domain P46898 11-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j3v X-ray 13.3 G 11-83 None
3j3w X-ray 10.7 G 11-83 None


© NPIDB team 2003 - 2019

text