Pfam domain
Pfam family: RNA_polI_A34 (PF08208.10)
Uniprot AC: P47006
RecName: DNA-directed RNA polymerase I subunit RPA34
Begin-End: 49-180
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KQQQVWLIKFPSNVDISKLKSLPVDFESSTTMTIDKHDYKIMDDTDIESSLTQDNLSNMT
LLVPSESKESLKIASTAKDNAPLQFDKVFSVSETAKIPAIDYSKVRVPRKDVPKVEGLKL
EHFATGYDAEDF
Structures of the domain P47006 49-180
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5w65 X-ray 4.3 N 50-179 None
5w5y X-ray 3.8 N 50-179 None
5w66 X-ray 3.9 N 50-179 None
5m5x X-ray 4 N 49-176 None
5m5y X-ray 4 N 49-176 None
5w64 X-ray 4.2 N 50-179 None
5oa1 X-ray 4.4 N 49-179 None
5m3f X-ray 3.8 N 49-179 None


© NPIDB team 2003 - 2019

text