Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: P47093
RecName: U6 snRNA-associated Sm-like protein LSm8
Begin-End: 3-66
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSEIA
LVGL
Structures of the domain P47093 3-66
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vsu X-ray 3.1 H 4-65 None
6aso X-ray 2.71 H 4-64 None
4m7a X-ray 2.78 H 5-65 None
4m7a X-ray 2.78 A 5-65 None
4m7a X-ray 2.78 H 5-65 None
4m7a X-ray 2.78 A 5-65 None
4m7d X-ray 2.6 H 4-65 None
4m7d X-ray 2.6 A 4-65 None
3jcm X-ray 3.8 b 4-65 None


© NPIDB team 2003 - 2019

text