Pfam domain
Pfam family: eIF-1a (PF01176.18)
Uniprot AC: P47813
RecName: Eukaryotic translation initiation factor 1A, X-chromosomal
Begin-End: 32-94
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADV
ILK
Structures of the domain P47813 32-94
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kzz X-ray 7.03 n 32-93 None
4kzy X-ray 7.01 n 32-93 None


© NPIDB team 2003 - 2019

text