Pfam domain
Pfam family: HMG_box (PF00505.21)
Uniprot AC: P48431
RecName: Transcription factor SOX-2
Begin-End: 41-109
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRAL
HMKEHPDYK
Structures of the domain P48431 41-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6t7b X-ray 5.1 K 41-109 None
1o4x NMR B 208-276  H-Bb H-Mj H-Mn L-Bb L-Mn 
6yov X-ray 3.42 L 41-109  H-Bb H-Mj H-Mn L-Bb L-Mn 
6t90 X-ray 3.05 L 41-109  H-Bb H-Mj H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text