Pfam domain
Pfam family: HMG_box (PF00505.18)
Uniprot AC: P48432
RecName: Transcription factor SOX-2
Begin-End: 43-111
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mn 

Sequence:
VKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRAL
HMKEHPDYK
Structures of the domain P48432 43-111
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1gt0 X-ray 2.6 D 3-71  H-Bb H-Mj H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2019

text