Pfam domain
Pfam family: Ribosomal_L7Ae (PF01248.25)
Uniprot AC: P48589
RecName: 40S ribosomal protein S12
Begin-End: 26-123
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DALKVVLRTALVHDGLARGLRESTKALTRGEALLVVLVSSVTEANIIKLVEGLANDPENK
VPLIKVADAKQLGEWAGLGKIDREGNARKVVGASVVVV
Structures of the domain P48589 26-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 M 27-122 None
6eml X-ray 3.6 D 9-104 None


© NPIDB team 2003 - 2019

text