Pfam domain
Pfam family: DNA_pol_D_N (PF18018.3)
Uniprot AC: P49005
RecName: DNA polymerase delta subunit 2
Begin-End: 49-176
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QYAHIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSIL
REVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDD
GKFLVEDY
Structures of the domain P49005 49-176
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tnz X-ray 4.05 B 49-176 None
6s1m X-ray 4.27 B 49-176 None
6s1n X-ray 4.86 B 49-176 None
6s1o X-ray 8.1 B 49-176 None
6tny X-ray 3.08 B 49-176 None


© NPIDB team 2003 - 2021

text