Pfam domain
Pfam family: Ribosomal_L37e (PF01907.18)
Uniprot AC: P49166
RecName: 60S ribosomal protein L37-A
Begin-End: 14-54
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAK
Structures of the domain P49166 14-54
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 j 196-235 None
6em3 X-ray 3.2 j 196-235 None
6em5 X-ray 4.3 j 196-236 None


© NPIDB team 2003 - 2019

text