Pfam domain
Pfam family: Ribosomal_L32p (PF01783.22)
Uniprot AC: P49228
RecName: 50S ribosomal protein L32
Begin-End: 5-59
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
PVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGYYDGRQVLA
Structures of the domain P49228 5-59
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1j5a X-ray 3.5 M 5-58 None
1k01 X-ray 3.5 M 5-58 None
1ond X-ray 3.4 Z 5-58 None
1jzy X-ray 3.5 M 5-58 None
1nwy X-ray 3.3 Z 5-58 None
1nwx X-ray 3.5 Z 5-58 None
2zjr X-ray 2.91 Z 5-58 None
1jzz X-ray 3.8 M 5-58 None
1xbp X-ray 3.5 Z 5-58 None
1nkw X-ray 3.1 Z 5-58 None
1jzx X-ray 3.1 M 5-58 None
3cf5 X-ray 3.3 Y 5-58 None
1sm1 X-ray 3.42 Z 5-58 None
3pio X-ray 3.25 Z 5-58 None
2zjp X-ray 3.7 Y 5-58 None
4ioc X-ray 3.6 Z 5-58 None
3pip X-ray 3.45 Z 5-58 None
4ioa X-ray 3.2 Z 5-58 None
4io9 X-ray 3.2 Z 5-58 None
2zjq X-ray 3.3 Z 5-58 None
4wfn X-ray 3.54 Z 5-58 None
3dll X-ray 3.5 Y 5-58 None
5dm6 X-ray 2.9 Z 5-58 None
5jvg X-ray 3.43 Z 5-58 None
5jvh X-ray 3.58 Z 5-58 None
5dm7 X-ray 3 Z 5-58 None
4u67 X-ray 3.65 Z 5-58 None


© NPIDB team 2003 - 2019

text