Pfam domain
Pfam family: Ribosomal_L19 (PF01245.19)
Uniprot AC: P49406
RecName: 39S ribosomal protein L19, mitochondrial
Begin-End: 93-197
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QIERKDMLERRKVLHIPEFYVGSILRVTTADPYASGKISQFLGICIQRSGRGLGATFILR
NVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEY
Structures of the domain P49406 93-197
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7y X-ray 3.4 Q 57-145 None
5oom X-ray 3.03 Q 57-144 None


© NPIDB team 2003 - 2019

text