Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P49450
RecName: Histone H3-like centromeric protein A
Begin-End: 48-133
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
LKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFE
DAYLLTLHAGRVTLFPKDVQLARRIR
Structures of the domain P49450 48-133
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3an2 X-ray 3.6 E 48-133 None
3an2 X-ray 3.6 A 47-133 None
3wtp X-ray 2.67 A 47-133  H-Bb H-Mj S-Bb L-Bb 
6c0w X-ray 4 E 47-133 None
6c0w X-ray 4 A 47-133 None
6buz X-ray 3.92 E 47-133 None
6buz X-ray 3.92 A 47-133 None


© NPIDB team 2003 - 2019

text