Pfam domain
Pfam family: Nop (PF01798.17)
Uniprot AC: P49704
RecName: Pre-mRNA-processing factor 31
Begin-End: 101-343
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IIPLIKSNIKLMHNFLISLYSRRFPELSSLIPSPLQYSKVISILENENYSKNESDELFFH
LENKAKLTREQILVLTMSMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIAS
KISIIAPNVCFLVGPEIAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVR
QEGYLFASDMIQKFPVSVHKQMLRMLCAKVSLAARVDAGQKNGDRNTVLAHKWKAELSKK
ARK
Structures of the domain P49704 101-343
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcm X-ray 3.8 I 105-342 None
5gap X-ray 3.6 F 105-342 None


© NPIDB team 2003 - 2019

text