Pfam domain
Pfam family: Prp31_C (PF09785.8)
Uniprot AC: P49704
RecName: Pre-mRNA-processing factor 31
Begin-End: 350-462
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ISETKALPIPEDQPKKKRAGRKFRKYKEKFRLSHVRQLQNRMEFGKQEQTVLDSYGEEVG
LGMSNTSLQQAVGATSGSRRSAGNQAKLTKVMKHRISEANQQADEFLISLGHN
Structures of the domain P49704 350-462
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcm X-ray 3.8 I 351-452 None


© NPIDB team 2003 - 2019

text