Pfam domain
Pfam family: TAF6_C (PF07571.12)
Uniprot AC: P49848
RecName: Transcription initiation factor TFIID subunit 6
Begin-End: 308-397
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEK
TPWTTRYGSIAGLAELGHDVIKTLILPRLQ
Structures of the domain P49848 308-397
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fur X-ray 8.5 J 308-397 None
5fur X-ray 8.5 K 308-397 None


© NPIDB team 2003 - 2020

text