Pfam domain
Pfam family: DNA_ligase_A_N (PF04675.13)
Uniprot AC: P49916
RecName: DNA ligase 3
Begin-End: 263-434
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb 

Sequence:
LREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLN
DKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLL
RLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSGAKHVLDALD
Structures of the domain P49916 263-434
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3l2p X-ray 3 A 177-346  H-Bb L-Bb 


© NPIDB team 2003 - 2019

text