Pfam domain
Pfam family: DNA_ligase_A_M (PF01068.20)
Uniprot AC: P49916
RecName: DNA ligase 3
Begin-End: 483-677
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
PMLAEACKSVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAHFK
DYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYFND
VSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKALDLADMITRVIQEGLEGLVLKDV
KGTYEPGKRHWLKVK
Structures of the domain P49916 483-677
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3l2p X-ray 3 A 396-590  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text