Pfam domain
Pfam family: DNA_ligase_A_C (PF04679.14)
Uniprot AC: P49916
RecName: DNA ligase 3
Begin-End: 704-814
Organism: Homo sapiens
Interaction Mode:  S-Bb S-Mn 

Sequence:
KGGMMSIFLMGCYDPGSQKWCTVTKCAGGHDDATLARLQNELDMVKISKDPSKIPSWLKV
NKIYYPDFIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDK
Structures of the domain P49916 704-814
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3l2p X-ray 3 A 618-727  S-Bb S-Mn 


© NPIDB team 2003 - 2019

text